PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe5G159600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 213aa    MW: 23764.5 Da    PI: 7.8822
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe5G159600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.11e-182974147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                       +g+W++eEd+ l ++v  +G ++W++I+r+++ gR++k+c++rw + 
  Aqcoe5G159600.1.p 29 KGPWSAEEDQTLTRLVDIHGARNWTLISRYIP-GRSGKSCRLRWCNQ 74
                       79******************************.***********985 PP

2Myb_DNA-binding53.84.6e-1783125347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        ++++ Ede ++ a++ +G++ W+tIa+ ++ gRt++ +k++w++ 
  Aqcoe5G159600.1.p  83 PFSQAEDEAILAAHQNYGNR-WATIAKLLP-GRTDNAVKNHWNST 125
                        79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.6572479IPR017930Myb domain
SuperFamilySSF466892.98E-3126122IPR009057Homeodomain-like
SMARTSM007173.6E-162877IPR001005SANT/Myb domain
PfamPF002497.0E-182974IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-243082IPR009057Homeodomain-like
CDDcd001671.20E-143173No hitNo description
SMARTSM007175.6E-1580128IPR001005SANT/Myb domain
PROSITE profilePS5129421.18181130IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.4E-2483129IPR009057Homeodomain-like
CDDcd001671.15E-1183126No hitNo description
PfamPF002492.8E-1483125IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MESNSSTSSS SSDQSNKQPR MITKTDRIKG PWSAEEDQTL TRLVDIHGAR NWTLISRYIP  60
GRSGKSCRLR WCNQLSPNVE HRPFSQAEDE AILAAHQNYG NRWATIAKLL PGRTDNAVKN  120
HWNSTLKRKQ REVKESSCGD EGQKLEVGMS LSAECDPLTV LTLAPPGVCS NSEQPQQMVE  180
QQGVTPEFWD VMRDVIAREV RNYVSSSFSG NV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-41261294107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010268609.14e-90PREDICTED: transcriptional activator Myb-like
SwissprotQ9FDW17e-56MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A059PRQ22e-82A0A059PRQ2_SALMI; MYB-related transcription factor
TrEMBLW9RIK83e-82W9RIK8_9R
STRINGGLYMA04G03910.16e-81(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.11e-56myb domain protein r1